General Information

  • ID:  hor001382
  • Uniprot ID:  A0A8J5JJV0
  • Protein name:  SIFamide
  • Gene name:  NA
  • Organism:  Homarus americanus (American lobster)
  • Family:  FMRFamide related peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  VYRKPPFNGSIF
  • Length:  12(28-39)
  • Propeptide:  MSVQMRVVVALALVLVIVAVLTDPVSAVYRKPPFNGSIFGKRAGADPLFEPGKGLASVCQVAVEACAAWFPVQEKK
  • Signal peptide:  MSVQMRVVVALALVLVIVAVLTDPVSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001382_AF2.pdbhor001382_ESM.pdb

Physical Information

Mass: 162103 Formula: C69H101N17O16
Absent amino acids: ACDEHLMQTW Common amino acids: FP
pI: 10.45 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -27.5 Boman Index: -1479
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 56.67
Instability Index: 208.33 Extinction Coefficient cystines: 1490
Absorbance 280nm: 135.45

Literature

  • PubMed ID:  22860213
  • Title:  Mass Spectral Charting of Neuropeptidomic Expression in the Stomatogastric Ganglion at Multiple Developmental Stages of the Lobster Homarus Americanus